Lineage for d1enfa2 (1enf A:102-213)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179787Protein Staphylococcal enterotoxin H, SEH [54346] (1 species)
  7. 2179788Species Staphylococcus aureus [TaxId:1280] [54347] (5 PDB entries)
  8. 2179789Domain d1enfa2: 1enf A:102-213 [37787]
    Other proteins in same PDB: d1enfa1
    complexed with so4

Details for d1enfa2

PDB Entry: 1enf (more details), 1.69 Å

PDB Description: crystal structure of staphylococcal enterotoxin h determined to 1.69 a resolution
PDB Compounds: (A:) enterotoxin h

SCOPe Domain Sequences for d1enfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enfa2 d.15.6.1 (A:102-213) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
eklaqerviganvwvdgiqketelirtnkknvtlqeldikirkilsdkykiyykdseisk
gliefdmktprdysfdiydlkgendyeidkiyednktlksddishidvnlyt

SCOPe Domain Coordinates for d1enfa2:

Click to download the PDB-style file with coordinates for d1enfa2.
(The format of our PDB-style files is described here.)

Timeline for d1enfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1enfa1