![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
![]() | Protein Photosystem I iron-sulfur protein PsaC [64272] (3 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:197221] [377867] (4 PDB entries) |
![]() | Domain d6pfyc_: 6pfy C: [377868] Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyd_, d6pfye_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyi_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfyr_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_ automated match to d1jb0c_ complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4 |
PDB Entry: 6pfy (more details), 2.9 Å
SCOPe Domain Sequences for d6pfyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pfyc_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Thermosynechococcus elongatus [TaxId: 197221]} ahtvkiydtcigctqcvracptdvlemvpwdgckagqiassprtedcvgckrcetacptd flsirvylgaettrsmglay
Timeline for d6pfyc_: