Lineage for d6tzud1 (6tzu D:1-298)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2834997Species Campylobacter jejuni [TaxId:192222] [377840] (1 PDB entry)
  8. 2835001Domain d6tzud1: 6tzu D:1-298 [377846]
    Other proteins in same PDB: d6tzub2, d6tzud2
    automated match to d3lera_
    complexed with act, edo, gol, mg, peg, pge; mutant

Details for d6tzud1

PDB Entry: 6tzu (more details), 1.8 Å

PDB Description: dihydrodipicolinate synthase (dhdps) from c.jejuni, n84a mutant with pyruvate bound in the active site
PDB Compounds: (D:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d6tzud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tzud1 c.1.10.1 (D:1-298) automated matches {Campylobacter jejuni [TaxId: 192222]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsaatheavglakfakehgadgilsvapyynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d6tzud1:

Click to download the PDB-style file with coordinates for d6tzud1.
(The format of our PDB-style files is described here.)

Timeline for d6tzud1: