SCOPe 2.08: Domain d6tzud1: 6tzu D:1-298

Lineage for d6tzud1 (6tzu D:1-298)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [377840] (1 PDB entry)

8. Domain d6tzud1: 6tzu D:1-298 [377846]
   Other proteins in same PDB: d6tzub2, d6tzud2
   automated match to d3lera_
   complexed with act, edo, gol, mg, peg, pge; mutant

Details for d6tzud1

PDB Entry: 6tzu, 1.8 Å

PDB Description: dihydrodipicolinate synthase (dhdps) from c.jejuni, n84a mutant with pyruvate bound in the active site

PDB Compounds: (D:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d6tzud1:

Sequence; same for both SEQRES and ATOM records:

>d6tzud1 c.1.10.1 (D:1-298) automated matches {Campylobacter jejuni [TaxId: 192222]}
mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehr
tcieiavetckgtkvkvlagagsaatheavglakfakehgadgilsvapyynkptqqgly
ehykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvkeasgnidkcvdlla
heprmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindel
yninkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

Timeline for d6tzud1:

• d6tzud1 first appeared in SCOPe 2.07