![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein automated matches [190095] (28 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [377840] (1 PDB entry) |
![]() | Domain d6tzuf_: 6tzu F: [377843] Other proteins in same PDB: d6tzub2, d6tzud2 automated match to d3lera_ complexed with act, edo, gol, mg, peg, pge; mutant |
PDB Entry: 6tzu (more details), 1.8 Å
SCOPe Domain Sequences for d6tzuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6tzuf_ c.1.10.1 (F:) automated matches {Campylobacter jejuni [TaxId: 192222]} kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc ieiavetckgtkvkvlagagsaatheavglakfakehgadgilsvapyynkptqqglyeh ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf
Timeline for d6tzuf_: