SCOP 1.63: Domain d1sebh2: 1seb H:127-235

Lineage for d1sebh2 (1seb H:127-235)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries)

8. Domain d1sebh2: 1seb H:127-235 [37784]
   Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh1

Details for d1sebh2

PDB Entry: 1seb, 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebh2:

Sequence; same for both SEQRES and ATOM records:

>d1sebh2 d.15.6.1 (H:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyetgyikfiene
nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt

Timeline for d1sebh2:

• d1sebh2 first appeared (with stable ids) in SCOP 1.55
  
• d1sebh2 appears in SCOP 1.61
  
• d1sebh2 appears in SCOP 1.65
  
• d1sebh2 appears in the current release, SCOPe 2.08