Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
Domain d1sebh2: 1seb H:127-235 [37784] Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh1 |
PDB Entry: 1seb (more details), 2.7 Å
SCOP Domain Sequences for d1sebh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sebh2 d.15.6.1 (H:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyetgyikfiene nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt
Timeline for d1sebh2: