Lineage for d1sebh2 (1seb H:127-235)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30645Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 30646Species Staphylococcus aureus [TaxId:1280] [54343] (10 PDB entries)
  8. 30658Domain d1sebh2: 1seb H:127-235 [37784]
    Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh1

Details for d1sebh2

PDB Entry: 1seb (more details), 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sebh2 d.15.6.1 (H:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyetgyikfiene
nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt

SCOP Domain Coordinates for d1sebh2:

Click to download the PDB-style file with coordinates for d1sebh2.
(The format of our PDB-style files is described here.)

Timeline for d1sebh2: