Lineage for d1sebd2 (1seb D:127-235)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) 
Domain d1sebd2: 1seb D:127-235 [37783]
Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh1
Details for d1sebd2
PDB Entry: 1seb (more details), 2.7 Å
PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb
PDB Compounds: (D:) enterotoxin type bSCOPe Domain Sequences for d1sebd2:
Sequence, based on SEQRES records: (download)
>d1sebd2 d.15.6.1 (D:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnspyetgy
ikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt
Sequence, based on observed residues (ATOM records): (download)
>d1sebd2 d.15.6.1 (D:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyetgyikfiene
nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt
SCOPe Domain Coordinates for d1sebd2:
Click to download the PDB-style file with coordinates for d1sebd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sebd2:
View in 3D
