SCOP 1.69: Domain d1sebd2: 1seb D:127-235

Lineage for d1sebd2 (1seb D:127-235)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)

8. Domain d1sebd2: 1seb D:127-235 [37783]
   Other proteins in same PDB: d1seba1, d1seba2, d1sebb1, d1sebb2, d1sebd1, d1sebe1, d1sebe2, d1sebf1, d1sebf2, d1sebh1

Details for d1sebd2

PDB Entry: 1seb, 2.7 Å

PDB Description: complex of the human mhc class ii glycoprotein hla-dr1 and the bacterial superantigen seb

SCOP Domain Sequences for d1sebd2:

Sequence; same for both SEQRES and ATOM records:

>d1sebd2 d.15.6.1 (D:127-235) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
dkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyetgyikfiene
nsfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylt

Timeline for d1sebd2:

• d1sebd2 first appeared (with stable ids) in SCOP 1.55
  
• d1sebd2 appears in SCOP 1.67
  
• d1sebd2 appears in SCOP 1.71
  
• d1sebd2 appears in the current release, SCOPe 2.08