Lineage for d1d5xc2 (1d5x C:122-238)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717870Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 717871Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (14 proteins)
  6. 717890Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 717891Species Staphylococcus aureus [TaxId:1280] [54343] (12 PDB entries)
  8. 717903Domain d1d5xc2: 1d5x C:122-238 [37782]
    Other proteins in same PDB: d1d5xa1, d1d5xa2, d1d5xb1, d1d5xb2, d1d5xc1
    complexed with ace, haq

Details for d1d5xc2

PDB Entry: 1d5x (more details), 2.45 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with dipeptide mimetic and seb
PDB Compounds: (C:) protein (enterotoxin type b)

SCOP Domain Sequences for d1d5xc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5xc2 d.15.6.1 (C:122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOP Domain Coordinates for d1d5xc2:

Click to download the PDB-style file with coordinates for d1d5xc2.
(The format of our PDB-style files is described here.)

Timeline for d1d5xc2: