| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
| Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [54343] (10 PDB entries) |
| Domain d1d5xc2: 1d5x C:122-238 [37782] Other proteins in same PDB: d1d5xa1, d1d5xa2, d1d5xb1, d1d5xb2, d1d5xc1 |
PDB Entry: 1d5x (more details), 2.45 Å
SCOP Domain Sequences for d1d5xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d5xc2 d.15.6.1 (C:122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
Timeline for d1d5xc2:
View in 3DDomains from other chains: (mouse over for more information) d1d5xa1, d1d5xa2, d1d5xb1, d1d5xb2 |