Lineage for d6pfye_ (6pfy e:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631519Superfamily f.23.17: Subunit VIII of photosystem I reaction centre, PsaI [81540] (1 family) (S)
  5. 2631520Family f.23.17.1: Subunit VIII of photosystem I reaction centre, PsaI [81539] (2 proteins)
  6. 2631521Protein Subunit VIII of photosystem I reaction centre, PsaI [81538] (2 species)
  7. 2631524Species Thermosynechococcus elongatus [TaxId:197221] [377780] (4 PDB entries)
  8. 2631530Domain d6pfye_: 6pfy e: [377781]
    Other proteins in same PDB: d6pfya_, d6pfyb_, d6pfyc_, d6pfyd_, d6pfyf_, d6pfyg_, d6pfyh_, d6pfyj_, d6pfyl_, d6pfym_, d6pfyn_, d6pfyo_, d6pfyp_, d6pfyq_, d6pfys_, d6pfyu_, d6pfyv_, d6pfyw_, d6pfyx_, d6pfyy_, d6pfyz_
    automated match to d1jb0i_
    complexed with bcr, ca, cl0, cla, lhg, lmg, pqn, sf4

Details for d6pfye_

PDB Entry: 6pfy (more details), 2.9 Å

PDB Description: membrane protein megahertz crystallography at the european xfel, photosystem i at synchrotron to 2.9 a
PDB Compounds: (e:) Photosystem I reaction center subunit VIII

SCOPe Domain Sequences for d6pfye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfye_ f.23.17.1 (e:) Subunit VIII of photosystem I reaction centre, PsaI {Thermosynechococcus elongatus [TaxId: 197221]}
mmgsyaasflpwifipvvcwlmptvvmgllflyiegea

SCOPe Domain Coordinates for d6pfye_:

Click to download the PDB-style file with coordinates for d6pfye_.
(The format of our PDB-style files is described here.)

Timeline for d6pfye_: