SCOPe 2.06: Domain d1se3a2: 1se3 A:122-239

Lineage for d1se3a2 (1se3 A:122-239)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)

8. Domain d1se3a2: 1se3 A:122-239 [37778]
   Other proteins in same PDB: d1se3a1

Details for d1se3a2

PDB Entry: 1se3, 2.3 Å

PDB Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide

PDB Compounds: (A:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d1se3a2:

Sequence; same for both SEQRES and ATOM records:

>d1se3a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

Timeline for d1se3a2:

• d1se3a2 first appeared (with stable ids) in SCOP 1.55, called d1se3_2
  
• d1se3a2 appears in SCOPe 2.05
  
• d1se3a2 appears in SCOPe 2.07
  
• d1se3a2 appears in the current release, SCOPe 2.08