Lineage for d1se3_2 (1se3 122-239)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30645Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 30646Species Staphylococcus aureus [TaxId:1280] [54343] (10 PDB entries)
  8. 30654Domain d1se3_2: 1se3 122-239 [37778]
    Other proteins in same PDB: d1se3_1

Details for d1se3_2

PDB Entry: 1se3 (more details), 2.3 Å

PDB Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide

SCOP Domain Sequences for d1se3_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se3_2 d.15.6.1 (122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

SCOP Domain Coordinates for d1se3_2:

Click to download the PDB-style file with coordinates for d1se3_2.
(The format of our PDB-style files is described here.)

Timeline for d1se3_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se3_1