SCOPe 2.08: Domain d6o41l1: 6o41 L:2-106

Lineage for d6o41l1 (6o41 L:2-106)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
Domain d6o41l1: 6o41 L:2-106 [377747]
Other proteins in same PDB: d6o41a2, d6o41c2, d6o41l2, d6o41m1, d6o41m2, d6o41n1, d6o41n2, d6o41o1, d6o41o2
automated match to d1dn0a1
complexed with gol

Details for d6o41l1

PDB Entry: 6o41 (more details), 2.47 Å

PDB Description: crystal structure of the unbound pgzl1 germline fab fragment (pgzl1_gvmdmj)

PDB Compounds: (L:) germline PGZL1_gVmDmJ light chain

SCOPe Domain Sequences for d6o41l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o41l1 b.1.1.1 (L:2-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgipd
rfsgsgsgtdftltisrlepedfavyycqqygtsqstfgqgtrlei

SCOPe Domain Coordinates for d6o41l1:

Click to download the PDB-style file with coordinates for d6o41l1.
(The format of our PDB-style files is described here.)

Timeline for d6o41l1: