Lineage for d1d5mc2 (1d5m C:122-237)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541495Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2541496Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2541501Domain d1d5mc2: 1d5m C:122-237 [37774]
    Other proteins in same PDB: d1d5ma1, d1d5ma2, d1d5mb1, d1d5mb2, d1d5mc1
    complexed with nag

Details for d1d5mc2

PDB Entry: 1d5m (more details), 2 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with peptide and seb
PDB Compounds: (C:) enterotoxin type b

SCOPe Domain Sequences for d1d5mc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5mc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

SCOPe Domain Coordinates for d1d5mc2:

Click to download the PDB-style file with coordinates for d1d5mc2.
(The format of our PDB-style files is described here.)

Timeline for d1d5mc2: