SCOPe 2.08: Domain d6o41a2: 6o41 A:107-213

Lineage for d6o41a2 (6o41 A:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d6o41a2: 6o41 A:107-213 [377736]
Other proteins in same PDB: d6o41a1, d6o41c1, d6o41l1, d6o41m1, d6o41m2, d6o41n1, d6o41n2, d6o41o1, d6o41o2
automated match to d1dn0a2
complexed with gol

Details for d6o41a2

PDB Entry: 6o41 (more details), 2.47 Å

PDB Description: crystal structure of the unbound pgzl1 germline fab fragment (pgzl1_gvmdmj)

PDB Compounds: (A:) germline PGZL1_gVmDmJ light chain

SCOPe Domain Sequences for d6o41a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o41a2 b.1.1.2 (A:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6o41a2:

Click to download the PDB-style file with coordinates for d6o41a2.
(The format of our PDB-style files is described here.)

Timeline for d6o41a2: