SCOPe 2.07: Domain d3seba2: 3seb A:122-238

Lineage for d3seba2 (3seb A:122-238)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)

8. Domain d3seba2: 3seb A:122-238 [37773]
   Other proteins in same PDB: d3seba1

Details for d3seba2

PDB Entry: 3seb, 1.48 Å

PDB Description: staphylococcal enterotoxin b

PDB Compounds: (A:) staphylococcal enterotoxin b

SCOPe Domain Sequences for d3seba2:

Sequence; same for both SEQRES and ATOM records:

>d3seba2 d.15.6.1 (A:122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d3seba2:

• d3seba2 first appeared (with stable ids) in SCOP 1.55, called d3seb_2
  
• d3seba2 appears in SCOPe 2.06
  
• d3seba2 appears in the current release, SCOPe 2.08