Lineage for d6l8qa2 (6l8q A:504-761)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902566Species Myotis davidii [TaxId:225400] [377687] (1 PDB entry)
  8. 2902567Domain d6l8qa2: 6l8q A:504-761 [377724]
    Other proteins in same PDB: d6l8qa1, d6l8qc1, d6l8qe1, d6l8qg1
    automated match to d1orva2
    complexed with nag

Details for d6l8qa2

PDB Entry: 6l8q (more details), 3.1 Å

PDB Description: complex structure of bat cd26 and mers-rbd
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d6l8qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l8qa2 c.69.1.0 (A:504-761) automated matches {Myotis davidii [TaxId: 225400]}
mprktldflhlngtkfwyqmilpphfdkskkypllidvyagpcsqkadatfklswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaakqfskmgfvddkriaiwg
wsyggyvtsmvlgagshvfkcgiavapvsawefydsvyterymglptpednldhyknstv
msraenfklveyllihgtaddnvhfqqsaqitralvdagvdfqamwytdedhgiatstah
qhiythmthfikqcfslp

SCOPe Domain Coordinates for d6l8qa2:

Click to download the PDB-style file with coordinates for d6l8qa2.
(The format of our PDB-style files is described here.)

Timeline for d6l8qa2: