![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
![]() | Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries) |
![]() | Domain d1ts4b2: 1ts4 B:294-394 [37772] Other proteins in same PDB: d1ts4a1, d1ts4b1 mutant |
PDB Entry: 1ts4 (more details), 3.4 Å
SCOP Domain Sequences for d1ts4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ts4b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus} lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltkihglyrssdktggy wkitmndgstyqsdlskkfeyntekppinideiktieaein
Timeline for d1ts4b2: