SCOPe 2.08: Domain d6ktbb2: 6ktb B:63-138

Lineage for d6ktbb2 (6ktb B:63-138)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.0: automated matches [254293] (1 protein)
   not a true family

6. Protein automated matches [254677] (2 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [377693] (2 PDB entries)

8. Domain d6ktbb2: 6ktb B:63-138 [377709]
   Other proteins in same PDB: d6ktba1, d6ktbb1
   automated match to d2ev0a2
   complexed with mg, mn, po4

Details for d6ktbb2

PDB Entry: 6ktb, 2.5 Å

PDB Description: crystal structure of b. halodurans mntr in apo form

PDB Compounds: (B:) HTH-type transcriptional regulator MntR

SCOPe Domain Sequences for d6ktbb2:

Sequence; same for both SEQRES and ATOM records:

>d6ktbb2 a.76.1.0 (B:63-138) automated matches {Bacillus halodurans [TaxId: 272558]}
takgkkigkrlvyrhdlledflkmigvdsdhiyedvegiehhlswdaidrigdlvqyfqe
dpsrlndlrevqkkne

Timeline for d6ktbb2:

• d6ktbb2 first appeared in SCOPe 2.07