Lineage for d6ktaa1 (6kta A:1-62)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694570Species Bacillus halodurans [TaxId:272558] [377691] (4 PDB entries)
  8. 2694573Domain d6ktaa1: 6kta A:1-62 [377704]
    Other proteins in same PDB: d6ktaa2, d6ktab2
    automated match to d2ev0a1
    complexed with gol

Details for d6ktaa1

PDB Entry: 6kta (more details), 2.3 Å

PDB Description: crystal structure of b. halodurans mntr in apo form
PDB Compounds: (A:) HTH-type transcriptional regulator MntR

SCOPe Domain Sequences for d6ktaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ktaa1 a.4.5.0 (A:1-62) automated matches {Bacillus halodurans [TaxId: 272558]}
mptpsmedyleriyllieekgyarvsdiaealevhpssvtkmvqkldksdylvyeryrgl
il

SCOPe Domain Coordinates for d6ktaa1:

Click to download the PDB-style file with coordinates for d6ktaa1.
(The format of our PDB-style files is described here.)

Timeline for d6ktaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6ktaa2