Lineage for d4tss_2 (4tss 94-194)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254471Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 254472Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)
  8. 254497Domain d4tss_2: 4tss 94-194 [37770]
    Other proteins in same PDB: d4tss_1
    complexed with zn

Details for d4tss_2

PDB Entry: 4tss (more details), 2.75 Å

PDB Description: toxic shock syndrome toxin-1: tetragonal p4(1)2(1)2 crystal form

SCOP Domain Sequences for d4tss_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tss_2 d.15.6.1 (94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOP Domain Coordinates for d4tss_2:

Click to download the PDB-style file with coordinates for d4tss_2.
(The format of our PDB-style files is described here.)

Timeline for d4tss_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tss_1