Lineage for d6joxb_ (6jox B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826027Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2826415Protein automated matches [196175] (9 species)
    not a true protein
  7. 2826448Species Scylla paramamosain [TaxId:85552] [377658] (1 PDB entry)
  8. 2826450Domain d6joxb_: 6jox B: [377683]
    automated match to d1wyia_

Details for d6joxb_

PDB Entry: 6jox (more details), 1.8 Å

PDB Description: triosephosphate isomerase-scylla paramamosain
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d6joxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6joxb_ c.1.1.1 (B:) automated matches {Scylla paramamosain [TaxId: 85552]}
qrkffvggnwkmngdkaaidgiisfmkgplnadtevvvgcpqcylmytrehmpanigvaa
qncyktakgaftgeispamikdcgcewvilghserrnvfgepdqlisekvghaleaglkv
ipcigekleeresnrteevvfaqmkalvpnisdwsrvviayepvwaigtgktatpeqaqd
vhaklrqwlrdnvspqvaestriiyggsvsagnckelaktgdidgflvggaslkpdfvti
inara

SCOPe Domain Coordinates for d6joxb_:

Click to download the PDB-style file with coordinates for d6joxb_.
(The format of our PDB-style files is described here.)

Timeline for d6joxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6joxa_