Lineage for d5tssb2 (5tss B:94-194)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 253998Fold d.15: beta-Grasp (ubiquitin-like) [54235] (10 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 254362Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 254363Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 254471Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 254472Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)
  8. 254494Domain d5tssb2: 5tss B:94-194 [37767]
    Other proteins in same PDB: d5tssa1, d5tssb1

Details for d5tssb2

PDB Entry: 5tss (more details), 2.9 Å

PDB Description: toxic shock syndrome toxin-1: orthorhombic p222(1) crystal form

SCOP Domain Sequences for d5tssb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tssb2 d.15.6.1 (B:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOP Domain Coordinates for d5tssb2:

Click to download the PDB-style file with coordinates for d5tssb2.
(The format of our PDB-style files is described here.)

Timeline for d5tssb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tssb1