![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (16 species) not a true protein |
![]() | Species Endosymbiont of [TaxId:54396] [377647] (1 PDB entry) |
![]() | Domain d6iusc2: 6ius C:140-447 [377667] Other proteins in same PDB: d6iusa1, d6iusb1, d6iusc1 automated match to d5hqma2 |
PDB Entry: 6ius (more details), 2.12 Å
SCOPe Domain Sequences for d6iusc2:
Sequence, based on SEQRES records: (download)
>d6iusc2 c.1.14.1 (C:140-447) automated matches {Endosymbiont of [TaxId: 54396]} gpavniqdmwrilgrpienggyiagtiikpklglrpepfaeaayqfwlggdfikndepqg nqpfspmkktiplvadamrraqdetgeaklfsanitaddpaemiargefvletfgfeasq vaflvdgyvagptavatarrnfpnqflhfhraghgavtspqskrgytafvhikmtrllga sgmhvgtmgygkmegeasdkliaymierdsadgpfyhqewagmkpttpiisggmnalrlp gffenlghgnvintagggtyghidspaagavslrqayecwkegadpveyakehkefaraf esfphdad
>d6iusc2 c.1.14.1 (C:140-447) automated matches {Endosymbiont of [TaxId: 54396]} gpavniqdmwrilgrpienggyiagtiikpklglrpepfaeaayqfwlggdfikndepqg nqpfspmkktiplvadamrraqdetgeaklfsanitaddpaemiargefvletfgfeasq vaflvdgyvagptavatarrnfpnqflhfhraghgavtspqskrgytafvhikmtrllga sgmhvgtasdkliaymierdsadgpfyhqewagmkpttpiisggmnalrlpgffenlghg nvintagggtyghidspaagavslrqayecwkegadpveyakehkefarafesfphdad
Timeline for d6iusc2:
![]() Domains from other chains: (mouse over for more information) d6iusa1, d6iusa2, d6iusb1, d6iusb2 |