Lineage for d6iusc1 (6ius C:5-139)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2559892Species Endosymbiont of [TaxId:54396] [377644] (1 PDB entry)
  8. 2559895Domain d6iusc1: 6ius C:5-139 [377666]
    Other proteins in same PDB: d6iusa2, d6iusb2, d6iusc2
    automated match to d5hqma1

Details for d6iusc1

PDB Entry: 6ius (more details), 2.12 Å

PDB Description: a higher kcat rubisco
PDB Compounds: (C:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d6iusc1:

Sequence, based on SEQRES records: (download)

>d6iusc1 d.58.9.0 (C:5-139) automated matches {Endosymbiont of [TaxId: 54396]}
qtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtnvevsttdd
ftkgvdalvyeideakelmkiaypvdlfdiniidgramlasfltltignnqgmgdieyak
mldfymppkylrlyd

Sequence, based on observed residues (ATOM records): (download)

>d6iusc1 d.58.9.0 (C:5-139) automated matches {Endosymbiont of [TaxId: 54396]}
qtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtgvdalvyei
deakelmkiaypvdlfdiniidgramlasfltltignnqgmgdieyakmldfymppkylr
lyd

SCOPe Domain Coordinates for d6iusc1:

Click to download the PDB-style file with coordinates for d6iusc1.
(The format of our PDB-style files is described here.)

Timeline for d6iusc1: