SCOPe 2.07: Domain d6iusc1: 6ius C:5-139

Lineage for d6iusc1 (6ius C:5-139)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Endosymbiont of [TaxId:54396] [377644] (1 PDB entry)

8. Domain d6iusc1: 6ius C:5-139 [377666]
   Other proteins in same PDB: d6iusa2, d6iusb2, d6iusc2
   automated match to d5hqma1

Details for d6iusc1

PDB Entry: 6ius, 2.12 Å

PDB Description: a higher kcat rubisco

PDB Compounds: (C:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d6iusc1:

Sequence, based on SEQRES records:

>d6iusc1 d.58.9.0 (C:5-139) automated matches {Endosymbiont of [TaxId: 54396]}
qtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtnvevsttdd
ftkgvdalvyeideakelmkiaypvdlfdiniidgramlasfltltignnqgmgdieyak
mldfymppkylrlyd

Sequence, based on observed residues (ATOM records):

>d6iusc1 d.58.9.0 (C:5-139) automated matches {Endosymbiont of [TaxId: 54396]}
qtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtgvdalvyei
deakelmkiaypvdlfdiniidgramlasfltltignnqgmgdieyakmldfymppkylr
lyd

Timeline for d6iusc1:

• d6iusc1 is new in SCOPe 2.07-stable
  
• d6iusc1 appears in the current release, SCOPe 2.08