Lineage for d6joxa_ (6jox A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) 
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
automatically mapped to Pfam PF00121
Protein automated matches [196175] (9 species)
not a true protein
Species Scylla paramamosain [TaxId:85552] [377658] (1 PDB entry) 
Domain d6joxa_: 6jox A: [377659]
automated match to d1wyia_
Details for d6joxa_
PDB Entry: 6jox (more details), 1.8 Å
PDB Description: triosephosphate isomerase-scylla paramamosain
PDB Compounds: (A:) triosephosphate isomeraseSCOPe Domain Sequences for d6joxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6joxa_ c.1.1.1 (A:) automated matches {Scylla paramamosain [TaxId: 85552]}
qrkffvggnwkmngdkaaidgiisfmkgplnadtevvvgcpqcylmytrehmpanigvaa
qncyktakgaftgeispamikdcgcewvilghserrnvfgepdqlisekvghaleaglkv
ipcigekleeresnrteevvfaqmkalvpnisdwsrvviayepvwaigtgktatpeqaqd
vhaklrqwlrdnvspqvaestriiyggsvsagnckelaktgdidgflvggaslkpdfvti
inara
SCOPe Domain Coordinates for d6joxa_:
Click to download the PDB-style file with coordinates for d6joxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6joxa_:
- d6joxa_ first appeared in SCOPe 2.07
View in 3D
