SCOPe 2.08: Domain d6iusa1: 6ius A:3-139

Lineage for d6iusa1 (6ius A:3-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Endosymbiont of [TaxId:54396] [377644] (1 PDB entry)

8. Domain d6iusa1: 6ius A:3-139 [377649]
   Other proteins in same PDB: d6iusa2, d6iusb2, d6iusc2
   automated match to d5hqma1

Details for d6iusa1

PDB Entry: 6ius, 2.12 Å

PDB Description: a higher kcat rubisco

PDB Compounds: (A:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d6iusa1:

Sequence, based on SEQRES records:

>d6iusa1 d.58.9.0 (A:3-139) automated matches {Endosymbiont of [TaxId: 54396]}
ldqtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtnvevstt
ddftkgvdalvyeideakelmkiaypvdlfdiniidgramlasfltltignnqgmgdiey
akmldfymppkylrlyd

Sequence, based on observed residues (ATOM records):

>d6iusa1 d.58.9.0 (A:3-139) automated matches {Endosymbiont of [TaxId: 54396]}
ldqtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtgvdalvy
eideakelmkiaypvdlfdiniidgramlasfltltignnqgmgdieyakmldfymppky
lrlyd

Timeline for d6iusa1:

• d6iusa1 first appeared in SCOPe 2.07