Lineage for d6iusb2 (6ius B:140-447)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838740Species Endosymbiont of [TaxId:54396] [377647] (1 PDB entry)
  8. 2838742Domain d6iusb2: 6ius B:140-447 [377648]
    Other proteins in same PDB: d6iusa1, d6iusb1, d6iusc1
    automated match to d5hqma2

Details for d6iusb2

PDB Entry: 6ius (more details), 2.12 Å

PDB Description: a higher kcat rubisco
PDB Compounds: (B:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d6iusb2:

Sequence, based on SEQRES records: (download)

>d6iusb2 c.1.14.1 (B:140-447) automated matches {Endosymbiont of [TaxId: 54396]}
gpavniqdmwrilgrpienggyiagtiikpklglrpepfaeaayqfwlggdfikndepqg
nqpfspmkktiplvadamrraqdetgeaklfsanitaddpaemiargefvletfgfeasq
vaflvdgyvagptavatarrnfpnqflhfhraghgavtspqskrgytafvhikmtrllga
sgmhvgtmgygkmegeasdkliaymierdsadgpfyhqewagmkpttpiisggmnalrlp
gffenlghgnvintagggtyghidspaagavslrqayecwkegadpveyakehkefaraf
esfphdad

Sequence, based on observed residues (ATOM records): (download)

>d6iusb2 c.1.14.1 (B:140-447) automated matches {Endosymbiont of [TaxId: 54396]}
gpavniqdmwrilgrpienggyiagtiikpklglrpepfaeaayqfwlggdfikndepqg
nqpfspmkktiplvadamrraqdetgeaklfsanitaddpaemiargefvletfgfeasq
vaflvdgyvagptavatarrnfpnqflhfhraghgavtspqskrgytafvhikmtrllga
sgmhvgtliaymierdsadgpfyhqewagmkpttpiisggmnalrlpgffenlghgnvin
tagggtyghidspaagavslrqayecwkegadpveyakehkefarafesfphdad

SCOPe Domain Coordinates for d6iusb2:

Click to download the PDB-style file with coordinates for d6iusb2.
(The format of our PDB-style files is described here.)

Timeline for d6iusb2: