Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Endosymbiont of [TaxId:54396] [377644] (1 PDB entry) |
Domain d6iusb1: 6ius B:3-139 [377646] Other proteins in same PDB: d6iusa2, d6iusb2, d6iusc2 automated match to d5hqma1 |
PDB Entry: 6ius (more details), 2.12 Å
SCOPe Domain Sequences for d6iusb1:
Sequence, based on SEQRES records: (download)
>d6iusb1 d.58.9.0 (B:3-139) automated matches {Endosymbiont of [TaxId: 54396]} ldqtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtnvevstt ddftkgvdalvyeideakelmkiaypvdlfdiniidgramlasfltltignnqgmgdiey akmldfymppkylrlyd
>d6iusb1 d.58.9.0 (B:3-139) automated matches {Endosymbiont of [TaxId: 54396]} ldqtnrysdlslkedeliasgdyvlcaylmkpksgygyleaaahfaaesstgtvdalvye ideakelmkiaypvdlfdiniidgramlasfltltignnqgmgdieyakmldfymppkyl rlyd
Timeline for d6iusb1:
View in 3D Domains from other chains: (mouse over for more information) d6iusa1, d6iusa2, d6iusc1, d6iusc2 |