Lineage for d1ts2b2 (1ts2 B:294-394)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541648Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 2541649Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 2541668Domain d1ts2b2: 1ts2 B:294-394 [37764]
    Other proteins in same PDB: d1ts2a1, d1ts2b1, d1ts2c1
    mutant

Details for d1ts2b2

PDB Entry: 1ts2 (more details), 2.3 Å

PDB Description: t128a mutant of toxic shock syndrome toxin-1 from s. aureus
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d1ts2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts2b2 d.15.6.1 (B:294-394) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaisaldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d1ts2b2:

Click to download the PDB-style file with coordinates for d1ts2b2.
(The format of our PDB-style files is described here.)

Timeline for d1ts2b2: