Lineage for d6heqa_ (6heq A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742108Domain d6heqa_: 6heq A: [377635]
    automated match to d5da4a_

Details for d6heqa_

PDB Entry: 6heq (more details), 1.23 Å

PDB Description: prion nanobody 484
PDB Compounds: (A:) Prion nanobody 484

SCOPe Domain Sequences for d6heqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6heqa_ b.1.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
vqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdyt
dsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwqqgtqvt
vs

SCOPe Domain Coordinates for d6heqa_:

Click to download the PDB-style file with coordinates for d6heqa_.
(The format of our PDB-style files is described here.)

Timeline for d6heqa_: