SCOPe 2.08: Domain d6umtb_: 6umt B:

Lineage for d6umtb_ (6umt B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6umtb_: 6umt B: [377613]
   Other proteins in same PDB: d6umta_
   automated match to d3bova_
   complexed with mg

Details for d6umtb_

PDB Entry: 6umt, 1.99 Å

PDB Description: high-affinity human pd-1 pd-l2 complex

PDB Compounds: (B:) Programmed cell death 1 ligand 2

SCOPe Domain Sequences for d6umtb_:

Sequence, based on SEQRES records:

>d6umtb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lftvtvpkelyiiehgsdvtlecnfdtgshvnlgaitaslqkveddtsphreratlleeq
lplgkasfhipqvqvrdegqyqciiiygvawdykyltlkvka

Sequence, based on observed residues (ATOM records):

>d6umtb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lftvtvpkelyiiehgsdvtlecnfdtgshvnlgaitaslqkvedphreratlleeqlpl
gkasfhipqvqvrdegqyqciiiygvawdykyltlkvka

Timeline for d6umtb_:

• d6umtb_ first appeared in SCOPe 2.07