Lineage for d1qilb2 (1qil B:94-194)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 854470Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 854471Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 854620Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 854621Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries)
  8. 854640Domain d1qilb2: 1qil B:94-194 [37761]
    Other proteins in same PDB: d1qila1, d1qilb1, d1qilc1

Details for d1qilb2

PDB Entry: 1qil (more details), 2.5 Å

PDB Description: inactive mutant toxic shock syndrome toxin-1 at 2.5 a
PDB Compounds: (B:) toxic shock syndrome toxin-1

SCOP Domain Sequences for d1qilb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qilb2 d.15.6.1 (B:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeiraqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOP Domain Coordinates for d1qilb2:

Click to download the PDB-style file with coordinates for d1qilb2.
(The format of our PDB-style files is described here.)

Timeline for d1qilb2: