Lineage for d1aw7d2 (1aw7 D:694-794)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30383Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 30633Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 30634Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 30714Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (1 species)
  7. 30715Species Staphylococcus aureus [TaxId:1280] [54341] (11 PDB entries)
  8. 30723Domain d1aw7d2: 1aw7 D:694-794 [37756]
    Other proteins in same PDB: d1aw7a1, d1aw7b1, d1aw7c1, d1aw7d1

Details for d1aw7d2

PDB Entry: 1aw7 (more details), 1.95 Å

PDB Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1aw7d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw7d2 d.15.6.1 (D:694-794) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhaltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOP Domain Coordinates for d1aw7d2:

Click to download the PDB-style file with coordinates for d1aw7d2.
(The format of our PDB-style files is described here.)

Timeline for d1aw7d2: