Lineage for d6pw0d2 (6pw0 D:130-281)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2380835Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2380999Protein automated matches [233094] (2 species)
    not a true protein
  7. 2381015Species Rhodobacter sphaeroides [TaxId:272943] [233095] (6 PDB entries)
  8. 2381025Domain d6pw0d2: 6pw0 D:130-281 [377520]
    Other proteins in same PDB: d6pw0a_, d6pw0b1, d6pw0b3, d6pw0c_, d6pw0d1, d6pw0d3
    automated match to d1m56b1
    complexed with ca, cd, cu, dmu, hea, hth, mal, mg, oh, trd, trs; mutant

Details for d6pw0d2

PDB Entry: 6pw0 (more details), 2.5 Å

PDB Description: cytochrome c oxidase delta 6 mutant
PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d6pw0d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pw0d2 b.6.1.2 (D:130-281) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

SCOPe Domain Coordinates for d6pw0d2:

Click to download the PDB-style file with coordinates for d6pw0d2.
(The format of our PDB-style files is described here.)

Timeline for d6pw0d2: