Lineage for d6q9ra4 (6q9r A:384-532)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576230Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2576247Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2576327Domain d6q9ra4: 6q9r A:384-532 [377512]
    automated match to d1d0na4
    complexed with cl, gol, so4, trs

Details for d6q9ra4

PDB Entry: 6q9r (more details), 2.73 Å

PDB Description: crystal structure of the pathological n184k variant of calcium-free human gelsolin
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d6q9ra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q9ra4 d.109.1.1 (A:384-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
sshianvervpfdaatlhtstamaaqhgmdddgtgqkqiwriegsnkvpvdpatygqfyg
gdsyiilynyrhggrqgqiiynwqgaqstqdevaasailtaqldeelggtpvqsrvvqgk
epahlmslfggkpmiiykggtsreggqta

SCOPe Domain Coordinates for d6q9ra4:

Click to download the PDB-style file with coordinates for d6q9ra4.
(The format of our PDB-style files is described here.)

Timeline for d6q9ra4: