Class a: All alpha proteins [46456] (290 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (99 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:316058] [193594] (35 PDB entries) |
Domain d6pqda_: 6pqd A: [377484] automated match to d3rwla_ complexed with cl, hem, ovp |
PDB Entry: 6pqd (more details), 1.89 Å
SCOPe Domain Sequences for d6pqda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pqda_ a.104.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 316058]} tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala rkvaaididgpvkrrfnntlrgleslpvkltpa
Timeline for d6pqda_: