![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins) eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF00812 |
![]() | Protein Ephrin-b2 ectodomain [74875] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [190026] (4 PDB entries) |
![]() | Domain d6pdlh_: 6pdl H: [377479] automated match to d3gxub_ complexed with bma, fuc, man, nag |
PDB Entry: 6pdl (more details), 2.7 Å
SCOPe Domain Sequences for d6pdlh_:
Sequence, based on SEQRES records: (download)
>d6pdlh_ b.6.1.5 (H:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]} sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa drctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegld nqeggvcqtramkilmkvgqd
>d6pdlh_ b.6.1.5 (H:) Ephrin-b2 ectodomain {Human (Homo sapiens) [TaxId: 9606]} sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa drctikntpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnq eggvcqtramkilmkvgqd
Timeline for d6pdlh_: