SCOP 1.57: Domain d1se2_2: 1se2 121-239

Lineage for d1se2_2 (1se2 121-239)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries)

8. Domain d1se2_2: 1se2 121-239 [37745]
   Other proteins in same PDB: d1se2_1

Details for d1se2_2

PDB Entry: 1se2, 2.7 Å

PDB Description: staphylococcal enterotoxin c2, monoclinic form

SCOP Domain Sequences for d1se2_2:

Sequence; same for both SEQRES and ATOM records:

>d1se2_2 d.15.6.1 (121-239) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkng

Timeline for d1se2_2:

• d1se2_2 first appeared (with stable ids) in SCOP 1.55
  
• d1se2_2 appears in SCOP 1.59
  
• d1se2_2 appears in the current release, SCOPe 2.08, called d1se2a2