SCOPe 2.08: Domain d6mxxf1: 6mxx F:1484-1537

Lineage for d6mxxf1 (6mxx F:1484-1537)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species)
   protein duplication: contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d6mxxf1: 6mxx F:1484-1537 [377437]
   Other proteins in same PDB: d6mxxa2, d6mxxb2, d6mxxc2, d6mxxc3, d6mxxd2, d6mxxe2, d6mxxf2, d6mxxg2, d6mxxh2, d6mxxi2, d6mxxj2, d6mxxj3
   automated match to d2lvma1
   protein/DNA complex; complexed with fmt, k6p, po4

Details for d6mxxf1

PDB Entry: 6mxx, 2.3 Å

PDB Description: structure of 53bp1 tandem tudor domains in complex with small molecule unc2991

PDB Compounds: (F:) TP53-binding protein 1

SCOPe Domain Sequences for d6mxxf1:

Sequence; same for both SEQRES and ATOM records:

>d6mxxf1 b.34.9.1 (F:1484-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nsfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

Timeline for d6mxxf1:

• d6mxxf1 first appeared in SCOPe 2.07