Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins) |
Protein Uridine-cytidine kinase 2 [102360] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries) |
Domain d6n55d_: 6n55 D: [377431] automated match to d1uejb_ complexed with gol, po4, uz0 |
PDB Entry: 6n55 (more details), 3.09 Å
SCOPe Domain Sequences for d6n55d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n55d_ c.37.1.6 (D:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl ptkkyadviiprgadnlvainlivqhiqdilng
Timeline for d6n55d_: