SCOPe 2.07: Domain d1stea2: 1ste A:121-238

Lineage for d1stea2 (1ste A:121-238)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54339] (8 PDB entries)

8. Domain d1stea2: 1ste A:121-238 [37743]
   Other proteins in same PDB: d1stea1
   complexed with zn

Details for d1stea2

PDB Entry: 1ste, 2 Å

PDB Description: staphylococcal enterotoxin c2 from staphylococcus aureus

PDB Compounds: (A:) staphylococcal enterotoxin c2

SCOPe Domain Sequences for d1stea2:

Sequence; same for both SEQRES and ATOM records:

>d1stea2 d.15.6.1 (A:121-238) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus [TaxId: 1280]}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkn

Timeline for d1stea2:

• d1stea2 first appeared (with stable ids) in SCOP 1.55, called d1ste_2
  
• d1stea2 appears in SCOPe 2.06
  
• d1stea2 appears in the current release, SCOPe 2.08