Lineage for d1ste_2 (1ste 121-238)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325763Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 325764Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins)
  6. 325795Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species)
  7. 325796Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries)
  8. 325799Domain d1ste_2: 1ste 121-238 [37743]
    Other proteins in same PDB: d1ste_1
    complexed with zn

Details for d1ste_2

PDB Entry: 1ste (more details), 2 Å

PDB Description: staphylococcal enterotoxin c2 from staphylococcus aureus

SCOP Domain Sequences for d1ste_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ste_2 d.15.6.1 (121-238) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkn

SCOP Domain Coordinates for d1ste_2:

Click to download the PDB-style file with coordinates for d1ste_2.
(The format of our PDB-style files is described here.)

Timeline for d1ste_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ste_1