Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies) |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins) |
Protein Staphylococcal enterotoxin C2, SEC2 [54338] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54339] (7 PDB entries) |
Domain d1ste_2: 1ste 121-238 [37743] Other proteins in same PDB: d1ste_1 |
PDB Entry: 1ste (more details), 2 Å
SCOP Domain Sequences for d1ste_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ste_2 d.15.6.1 (121-238) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus} nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkn
Timeline for d1ste_2: