Lineage for d6n55h_ (6n55 H:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474782Family c.37.1.6: Phosphoribulokinase/pantothenate kinase [52584] (6 proteins)
  6. 2474806Protein Uridine-cytidine kinase 2 [102360] (1 species)
  7. 2474807Species Human (Homo sapiens) [TaxId:9606] [102361] (10 PDB entries)
  8. 2474841Domain d6n55h_: 6n55 H: [377425]
    automated match to d1uejb_
    complexed with gol, po4, uz0

Details for d6n55h_

PDB Entry: 6n55 (more details), 3.09 Å

PDB Description: crystal structure of human uridine-cytidine kinase 2 complexed with 2'-azidouridine
PDB Compounds: (H:) Uridine-cytidine kinase 2

SCOPe Domain Sequences for d6n55h_:

Sequence, based on SEQRES records: (download)

>d6n55h_ c.37.1.6 (H:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
ptkkyadviiprgadnlvainlivqhiqdilng

Sequence, based on observed residues (ATOM records): (download)

>d6n55h_ c.37.1.6 (H:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}
epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvleqkakalkgq
fnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegilaf
ysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclpt
kkyadviiprgadnlvainlivqhiqdilng

SCOPe Domain Coordinates for d6n55h_:

Click to download the PDB-style file with coordinates for d6n55h_.
(The format of our PDB-style files is described here.)

Timeline for d6n55h_: