Lineage for d1i4hb2 (1i4h B:121-233)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179689Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2179690Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2179700Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 2179701Species Staphylococcus aureus [TaxId:1280] [54337] (6 PDB entries)
  8. 2179709Domain d1i4hb2: 1i4h B:121-233 [37742]
    Other proteins in same PDB: d1i4ha1, d1i4hb1
    complexed with zn; mutant

Details for d1i4hb2

PDB Entry: 1i4h (more details), 2.9 Å

PDB Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a
PDB Compounds: (B:) enterotoxin type a

SCOPe Domain Sequences for d1i4hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4hb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus [TaxId: 1280]}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOPe Domain Coordinates for d1i4hb2:

Click to download the PDB-style file with coordinates for d1i4hb2.
(The format of our PDB-style files is described here.)

Timeline for d1i4hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4hb1