Lineage for d1i4hb2 (1i4h B:121-233)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77788Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)
  4. 78065Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 78066Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)
  6. 78067Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)
  7. 78068Species Staphylococcus aureus [TaxId:1280] [54337] (5 PDB entries)
  8. 78076Domain d1i4hb2: 1i4h B:121-233 [37742]
    Other proteins in same PDB: d1i4ha1, d1i4hb1

Details for d1i4hb2

PDB Entry: 1i4h (more details), 2.9 Å

PDB Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a

SCOP Domain Sequences for d1i4hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4hb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOP Domain Coordinates for d1i4hb2:

Click to download the PDB-style file with coordinates for d1i4hb2.
(The format of our PDB-style files is described here.)

Timeline for d1i4hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i4hb1