SCOP 1.55: Domain d1i4hb2: 1i4h B:121-233

Lineage for d1i4hb2 (1i4h B:121-233)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Staphylococcal enterotoxin A, SEA [54336] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54337] (4 PDB entries)

8. Domain d1i4hb2: 1i4h B:121-233 [37742]
   Other proteins in same PDB: d1i4ha1, d1i4hb1

Details for d1i4hb2

PDB Entry: 1i4h, 2.9 Å

PDB Description: crystal structure of zn2+ soaked staphylococcal enterotoxin a mutant h187a

SCOP Domain Sequences for d1i4hb2:

Sequence; same for both SEQRES and ATOM records:

>d1i4hb2 d.15.6.1 (B:121-233) Staphylococcal enterotoxin A, SEA {Staphylococcus aureus}
eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
rglivfatstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts

SCOP Domain Coordinates for d1i4hb2 are not available.

Timeline for d1i4hb2:

• d1i4hb2 appears in SCOP 1.57
  
• d1i4hb2 appears in the current release, SCOPe 2.08