SCOPe 2.08: Domain d6mxxj2: 6mxx J:1538-1602

Lineage for d6mxxj2 (6mxx J:1538-1602)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species)
   protein duplication: contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d6mxxj2: 6mxx J:1538-1602 [377400]
   Other proteins in same PDB: d6mxxa1, d6mxxb1, d6mxxc1, d6mxxc3, d6mxxd1, d6mxxe1, d6mxxf1, d6mxxg1, d6mxxh1, d6mxxi1, d6mxxj1, d6mxxj3
   automated match to d1ssfa2
   protein/DNA complex; complexed with fmt, k6p, po4

Details for d6mxxj2

PDB Entry: 6mxx, 2.3 Å

PDB Description: structure of 53bp1 tandem tudor domains in complex with small molecule unc2991

PDB Compounds: (J:) TP53-binding protein 1

SCOPe Domain Sequences for d6mxxj2:

Sequence; same for both SEQRES and ATOM records:

>d6mxxj2 b.34.9.1 (J:1538-1602) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

Timeline for d6mxxj2:

• d6mxxj2 first appeared in SCOPe 2.07